PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009104654.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 613aa    MW: 69073.6 Da    PI: 6.6277
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009104654.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix91.31e-2853137187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++qe+laL+++r++m+ ++r+++ k+plWeevs+km+e g+ r++k+Ckek+en+ k++k++keg+ ++++++  t+++fdqlea
  XP_009104654.1  53 RWPRQETLALLKIRSDMGIAFRDSSVKGPLWEEVSRKMAELGYIRNAKKCKEKFENVYKYHKRTKEGRTGKSEGK--TYRFFDQLEA 137
                     8********************************************************************975544..6*******85 PP

2trihelix104.29.6e-33408493187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k e+ aLi++r++++++++++  k+plWee+s+ m++ gf+r++k+Ckekwen+nk++kk+ke++kkr +e+s+tcpyf+ql+a
  XP_009104654.1 408 RWPKVEIEALIKLRTNLDSKYQENGPKGPLWEEISAGMKRLGFNRNSKRCKEKWENINKYFKKVKESNKKR-PEDSKTCPYFHQLDA 493
                     8*********************************************************************8.99***********85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.08850112IPR001005SANT/Myb domain
PfamPF138374.5E-1852138No hitNo description
CDDcd122032.61E-2252117No hitNo description
PROSITE profilePS500906.95752110IPR017877Myb-like domain
PROSITE profilePS500907.166401465IPR017877Myb-like domain
SMARTSM007170.0023405467IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-4405464IPR009057Homeodomain-like
PfamPF138374.2E-22407494No hitNo description
CDDcd122031.59E-26408472No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MMQLGGTTTT AVTSATPPPS NDSAATEAAA AAATVGAFEV SEEMNDRGFG GNRWPRQETL  60
ALLKIRSDMG IAFRDSSVKG PLWEEVSRKM AELGYIRNAK KCKEKFENVY KYHKRTKEGR  120
TGKSEGKTYR FFDQLEALET RPTSSSLHHQ QQQQPPPQTQ PQPLQPQPPL RPHNNNSSMF  180
PTPPPVTTIT PQITNTTLPP YTQPVNVPSF PNISGDFLSD DSTSSSHSTS SDVEVGDGTT  240
MTRKKKRKRK WKEFFERLTR QVVDKQEELQ RKFLEAVEKR EHERLVREES WRVQEIARIN  300
RERDILAQER SMSAAKDAAV MAFLQKLSEK PNPQGQSIPQ QQPQPQQPPS QMQVNNNNNQ  360
QTPQPPPPPI SQPTQPVTPT VDTSKTDNGD QNMTPVSASA AGALSSSRWP KVEIEALIKL  420
RTNLDSKYQE NGPKGPLWEE ISAGMKRLGF NRNSKRCKEK WENINKYFKK VKESNKKRPE  480
DSKTCPYFHQ LDALYRERNK FHTSNNVIAS SSSTSGLVKP DNSVPLMVQP EQQWPPAMAT  540
TTMTSTVAAT AQPDQHPPPQ PLDKNFDDEE GTDGEEYDEE EDYEENEEEE GGEFELVPSN  600
NNNNNNNKPT NNM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1243249KKKRKRK
2244249KKRKRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.143600.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892030.0AC189203.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB006H21, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009104654.10.0PREDICTED: trihelix transcription factor GT-2
SwissprotQ391171e-143TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM4CHM00.0M4CHM0_BRARP; Uncharacterized protein
STRINGBra003703.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM48492553
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.10.0Trihelix family protein